missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ENTPD5 Partial ORF (NP_001240, 319 a.a. - 400 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000957-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16135904

  • 3343.96 SEK / 10µg

Estimated Shipment: 06-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is similar to E-type nucleotidases (NTPases)/ecto-ATPase/apyrases. NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD5 contains 4 apyrase-conserved regions which is characteristic of NTPases. [provided by RefSeq]

Sequence: EEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQ
Specifications

Specifications

NP_001240
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.76kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
EEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQ
RUO
ENTPD5
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
957
ENTPD5 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CD39L4/MGC163357/MGC163359/NTPDase-5/PCPH
ENTPD5
Yes
Videos
SDS
Documents
Certificates