missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human EXOSC6 Partial ORF (NP_478126, 3 a.a. - 66 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00118460-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16181597

  • 5030.41 SEK / 25µg

Estimated Shipment: 02-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene product constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. The composition of human exosome is similar to its yeast counterpart. This protein is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening. The exosome does not recognize ARE-containing mRNAs on its own, but requires ARE-binding proteins that could interact with the exosome and recruit it to unstable mRNAs, thereby promoting their rapid degradation. [provided by RefSeq]

Sequence: GDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAV
Specifications

Specifications

NP_478126
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.78kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAV
RUO
EXOSC6
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
118460
EXOSC6 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
EAP4/MTR3/Mtr3p/hMtr3p/p11
EXOSC6
Yes
Videos
SDS
Documents
Certificates