missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human EYS Partial ORF (XP_498111, 309 a.a. - 407 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00346007-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
The product of this gene contains multiple epidermal growth factor (EGF)-like and LamG domains. The protein is expressed in the photoreceptor layer of the retina, and the gene is mutated in autosomal recessive retinitis pigmentosa. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: HVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNYDGICYLGGFEYGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNIELIKLEGYNVYDGDEQNEVTSpecifications
| XP_498111 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.63kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| HVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNYDGICYLGGFEYGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNIELIKLEGYNVYDGDEQNEVT | |
| RUO | |
| EYS | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 346007 | |
| EYS (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| C6orf178/C6orf179/C6orf180/EGFL10/EGFL11/KIAA0663/RP25/SPAM/bA166P24.2/bA307F22.3/bA74E24.1/dJ1018A4.2/dJ22I17.2/dJ303F19.1 | |
| EYS | |
| Recombinant | |
| wheat germ expression system |