missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human FCAR Partial ORF (AAH27953, 24 a.a. - 133 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
4515.00 SEK - 6845.00 SEK
Specifications
| Accession Number | AAH27953 |
|---|---|
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 2204 |
| Molecular Weight (g/mol) | 37.84kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16174871
|
Abnova™
H00002204-Q01.10UG |
10 ug |
4515.00 SEK
10µg |
Estimated Shipment: 23-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16184871
|
Abnova™
H00002204-Q01.25UG |
25 ug |
6845.00 SEK
25µg |
Estimated Shipment: 23-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
This gene is a member of the immunoglobulin gene superfamily and encodes a receptor for the Fc region of IgA. The receptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eosinophils, where it mediates immunologic responses to pathogens. It interacts with IgA-opsonized targets and triggers several immunologic defense processes, including phagocytosis, antibody-dependent cell-mediated cytotoxicity, and stimulation of the release of inflammatory mediators. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq]
Sequence: GDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGSpecifications
| AAH27953 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.84kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CD89 | |
| FCAR | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 2204 | |
| FCAR (Human) Recombinant Protein (Q01) | |
| GDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRG | |
| RUO | |
| FCAR | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |