missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FER1L3 Partial ORF (NP_038479, 655 a.a. - 754 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00026509-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16185516

  • 5030.41 SEK / 25µg

Estimated Shipment: 03-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. The protein encoded by this gene is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Two transcript variants encoding different isoforms have been found for this gene. Other possible variants have been detected, but their full-length nature has not been determined. [provided by RefSeq]

Sequence: DAVNTLLAMAERLQTNIEALKSGIQGKIPANQLAELWLKLIDEVIEDTRYTLPLTEGKANVTVLDTQIRKLRSRSLSQIHEAAVRMRSEATDVKSTLAEI
Specifications

Specifications

NP_038479
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DAVNTLLAMAERLQTNIEALKSGIQGKIPANQLAELWLKLIDEVIEDTRYTLPLTEGKANVTVLDTQIRKLRSRSLSQIHEAAVRMRSEATDVKSTLAEI
RUO
MYOF
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
26509
FER1L3 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FER1L3/FLJ36571/FLJ90777
MYOF
Yes
Videos
SDS
Documents
Certificates