missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FGF1 Partial ORF (AAH32697, 46 a.a. - 155 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00002246-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16184931

  • 3343.96 SEK / 10µg

Estimated Shipment: 09-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq]

Sequence: VDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Specifications

Specifications

AAH32697
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.73kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
VDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
RUO
FGF1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
2246
FGF1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AFGF/ECGF/ECGF-beta/ECGFA/ECGFB/FGF-alpha/FGFA/GLIO703/HBGF1
FGF1
Yes
Videos
SDS
Documents
Certificates