missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FKHL18 Partial ORF (NP_004109.1, 1 a.a. - 95 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00002307-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16064025

  • 3234.00 SEK / 10µg


Estimated Shipment
09-02-2021
Add to basket

Description

Description

The forkhead family of transcription factors belongs to the winged helix class of DNA-binding proteins. The protein encoded by this intronless gene contains a forkhead domain and is found predominantly in aorta and kidney. The function of the encoded protein is unknown. [provided by RefSeq]

Sequence: MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLD
Specifications

Specifications

NP_004109.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.19kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLD
RUO
FOXS1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
2307
FKHL18 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FKHL18|FREAC10|MGC4544
FOXS1
Yes
Videos
SDS
Documents