missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human FOXQ1 Partial ORF (NP_150285.3, 133 a.a. - 223 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
4515.00 SEK - 6845.00 SEK
Specifications
Accession Number | NP_150285.3 |
---|---|
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 94234 |
Molecular Weight (g/mol) | 35.64kDa |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16025755
|
Abnova™
H00094234-Q02.25UG |
25 ug |
6845.00 SEK
25µg |
Estimated Shipment: 29-08-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
16015755
|
Abnova™
H00094234-Q02.10UG |
10 ug |
4515.00 SEK
10µg |
Estimated Shipment: 29-08-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
FOXQ1 is a member of the FOX gene family, which is characterized by a conserved 110-amino acid DNA-binding motif called the forkhead or winged helix domain. FOX genes are involved in embryonic development, cell cycle regulation, tissue-specific gene expression, cell signaling, and tumorigenesis (Bieller et al., 2001 [PubMed 11747606]).[supplied by OMIM]
Sequence: RDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHRAPVPSpecifications
NP_150285.3 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.64kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
HFH1 | |
FOXQ1 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
94234 | |
FOXQ1 (Human) Recombinant Protein (Q02) | |
RDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHRAPVP | |
RUO | |
FOXQ1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |