missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FOXQ1 Partial ORF (NP_150285.3, 133 a.a. - 223 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

4515.00 SEK - 6845.00 SEK

Specifications

Accession Number NP_150285.3
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 94234
Molecular Weight (g/mol) 35.64kDa
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16025755
View Documents Promotion Details
Abnova™
H00094234-Q02.25UG
25 ug
6845.00 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 24-06-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16015755
View Documents Promotion Details
Abnova™
H00094234-Q02.10UG
10 ug
4515.00 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 24-06-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

FOXQ1 is a member of the FOX gene family, which is characterized by a conserved 110-amino acid DNA-binding motif called the forkhead or winged helix domain. FOX genes are involved in embryonic development, cell cycle regulation, tissue-specific gene expression, cell signaling, and tumorigenesis (Bieller et al., 2001 [PubMed 11747606]).[supplied by OMIM]

Sequence: RDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHRAPVP
Specifications

Specifications

NP_150285.3
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.64kDa
12.5% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HFH1
FOXQ1
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
94234
FOXQ1 (Human) Recombinant Protein (Q02)
RDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHRAPVP
RUO
FOXQ1
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documents

Documents

Product Certifications