missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human Gage12B Full-Length Orf (Adr82812.1, 1 A.A.-117 A.A.) Recombinant Protein With Gst Tag At N-Terminal.

Recombinant proteins expressed from in vitro wheat germ system. Such proteins mirror the conformation and folding of the native proteins in the eukaryotic biological system.

Brand:  Abnova™ H00729428-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16130844

  • 3343.96 SEK / 10µg

Estimated Shipment: 09-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Good Folding
  • Excellent amino acids labeling

Immunogen Sequence: MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQCQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Specifications

Specifications

ADR82812.1
Liquid
729428
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC163246
GAGE12B
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
GAGE12B (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue
MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQCQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC
RUO
GAGE12B
GST
Videos
SDS
Documents
Certificates

For Research Use Only