missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human Gage12B Full-Length Orf (Adr82812.1, 1 A.A.-117 A.A.) Recombinant Protein With Gst Tag At N-Terminal.
Recombinant proteins expressed from in vitro wheat germ system. Such proteins mirror the conformation and folding of the native proteins in the eukaryotic biological system.
Brand: Abnova™ H00729428-P01.10ug
Additional Details : Weight : 0.00010kg
Description
- Good Folding
- Excellent amino acids labeling
Immunogen Sequence: MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQCQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC
Specifications
| ADR82812.1 | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| GAGE12B (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQCQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC | |
| RUO | |
| GAGE12B | |
| GST |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 729428 | |
| Glutathione Sepharose 4 Fast Flow | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MGC163246 | |
| GAGE12B | |
| Liquid |
For Research Use Only