missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GALNT13 Partial ORF (NP_443149.1, 47 a.a. - 151 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00114805-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16131427

  • 5030.41 SEK / 25µg

Estimated Shipment: 09-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The GALNT13 protein is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAcT; EC 2.4.1.41) family, which initiate O-linked glycosylation of mucins (see MUC3A, MIM 158371) by the initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue.[supplied by OMIM]

Sequence: RAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVI
Specifications

Specifications

NP_443149.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.29kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVI
RUO
GALNT13
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
114805
GALNT13 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ16031/FLJ41157/GalNAc-T13/H_NH0187G20.1/KIAA1918/MGC119459/MGC119461/WUGSC:H_NH0187G20.1
GALNT13
Yes
Videos
SDS
Documents
Certificates