missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GALNT14 Partial ORF (NP_078848.2, 494 a.a. - 551 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00079623-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16130027

  • 3343.96 SEK / 10µg

Estimated Shipment: 14-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

GALNT14 (EC 2.4.1.41) belongs to a large subfamily of glycosyltransferases residing in the Golgi apparatus. GALNT enzymes catalyze the first step in the O-glycosylation of mammalian proteins by transferring N-acetyl-D-galactosamine (GalNAc) to peptide substrates.[supplied by OMIM]

Sequence: KNGDDRQQWTKTGSHIEHIASHLCLDTDMFGDGTENGKEIVVNPCESSLMSQHWDMVS
Specifications

Specifications

NP_078848.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.12kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KNGDDRQQWTKTGSHIEHIASHLCLDTDMFGDGTENGKEIVVNPCESSLMSQHWDMVS
RUO
GALNT14
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
79623
GALNT14 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ12691/FLJ13977/GALNT15/GalNac-T10/GalNac-T14
GALNT14
Yes
Videos
SDS
Documents
Certificates