missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GAPDH Partial ORF (NP_002037, 226 a.a. - 335 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00002597-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16185321

  • 5030.41 SEK / 25µg

Estimated Shipment: 08-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. [provided by RefSeq]

Sequence: GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
Specifications

Specifications

NP_002037
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
RUO
GAPDH
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
2597
GAPDH (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
G3PD/GAPD/MGC88685
GAPDH
Yes
Videos
SDS
Documents
Certificates