Learn More
Abnova™ Human GATA1 Partial ORF (ENSP00000365858, 123 a.a. - 199 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00002623-Q01.10ug
Additional Details : Weight : 0.02000kg
Description
This gene encodes a protein which belongs to the GATA family of transcription factors. The protein plays an important role in erythroid development by regulating the switch of fetal hemoglobin to adult hemoglobin. Mutations in this gene have been associated with X-linked dyserythropoietic anemia and thrombocytopenia. [provided by RefSeq]
Sequence: DLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPCSpecifications
ENSP00000365858 | |
Liquid | |
2623 | |
GATA1 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ERYF1/GF-1/GF1/NFE1 | |
GATA1 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
34.21kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
DLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPC | |
RUO | |
GATA1 | |
Wheat Germ (in vitro) | |
GST |