missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GIOT-1 Partial ORF (NP_694989.2, 121 a.a. - 218 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00092283-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16131207

  • 5030.41 SEK / 25µg

Estimated Shipment: 14-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: ELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFSYHLFFSHHKRTHSKEL
Specifications

Specifications

NP_694989.2
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFSYHLFFSHHKRTHSKEL
RUO
ZNF461
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
92283
GIOT-1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GIOT-1/GIOT1/MGC33911
ZNF461
Yes
Videos
SDS
Documents
Certificates