missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30207245

Invitrogen™ Human GLRX (aa 57-88) Control Fragment Recombinant Protein

Produktkod. 30207245
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30207245

Brand: Invitrogen™ RP104818

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65437 (PA5-65437. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glutaredoxin (Grx), also known as thiol transferase, is a small heat-stable oxidoreductase. Grxs form part of the glutaredoxin system, comprising NADPH, GSH and glutathione reductase, which transfers electrons from NADPH to glutaredoxins via GSH. First recovered in E.coli as GSH-dependent hydrogen donors for ribonucleotide reductase, Grx catalyzes GSH-disulfide oxidoreductase via two redox-active cysteine residues. The active sequence (Cys-Pro-Tyr-Cys) is conserved in a variety of species. The 12-kDa dithiol protein has a role in reduction of mixed disulfides in cells exposed to oxidative stress.
TRUSTED_SUSTAINABILITY

Spezifikation

Tillträdesnummer P35754
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 2745
Namn Human GLRX (aa 57-88) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias C86710; D13Wsu156e; GLRX; Glrx1; GLRXL; glutaredoxin; glutaredoxin (thioltransferase); glutaredoxin 1; glutaredoxin 1 (thioltransferase); Glutaredoxin1; glutaredoxin-1; Grx; Grx 1; Grx1; MGC117; MGC117407; thiol disulfide oxidoreductase; thioltransferase; Thioltransferase 1; thioltransferase; TTase; Thioltransferase1; Thioltransferase-1; TTase; TTase 1; TTase1; TTase-1; TTF; Unknown (protein for MGC:133817)
Vanligt namn GLRX
Gensymbol GLRX
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens IQDYLQQLTGARTVPRVFIGKDCIGGCSDLVS
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt