Learn More
Abnova™ Human GMEB1 Partial ORF (NP_077808, 467 a.a. - 563 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00010691-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene is a member of KDWK gene family. The product of this gene associates with GMEB2 protein, and the complex is essential for parvovirus DNA replication. Study of rat homolog implicates the role of this gene in modulation of transactivation by the glucocorticoid receptor bound to glucocorticoid response elements. Two alternative spliced transcript variants encoding different isoforms exist. [provided by RefSeq]
Sequence: TAMQDGSTLGNMTTMVSPVELVAMESGLTSAIQAVESTSEDGQTIIEIDPAPDPEAEDTEGKAVILETELRTEEKVVAEMEEHQHQVHNVEIVVLEDSpecifications
NP_077808 | |
Liquid | |
10691 | |
GMEB1 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
P96PIF/PIF96 | |
GMEB1 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.41kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
TAMQDGSTLGNMTTMVSPVELVAMESGLTSAIQAVESTSEDGQTIIEIDPAPDPEAEDTEGKAVILETELRTEEKVVAEMEEHQHQVHNVEIVVLED | |
RUO | |
GMEB1 | |
Wheat Germ (in vitro) | |
GST |