missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human GMPS (aa 13-152) Control Fragment Recombinant Protein

Produktkod. 30211289
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
30211289 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30211289 Leverantör Invitrogen™ Leverantörsnummer RP106132
 Begränsad artikel
Beräknad leverans: 11-09-2026
Lägg i varukorgen
Lägg i varukorgen
Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65452. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcription factor which plays a key role in defining the composition of the RNA polymerase II (RNAPII) elongation complex and in modulating the production of mature mRNA transcripts. Acts as an assembly factor to recruit various factors to the RNAPII elongation complex and is recruited to the complex via binding to the transcription elongation factor SUPT6H bound to the C-terminal domain (CTD) of the RNAPII subunit RPB1 (POLR2A). The SUPT6H:IWS1:CTD complex recruits mRNA export factors (ALYREF/THOC4, EXOSC10) as well as histone modifying enzymes (such as SETD2) to ensure proper mRNA splicing, efficient mRNA export and elongation-coupled H3K36 methylation, a signature chromatin mark of active transcription.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer P49915
Koncentration ≥5.0 mg/mL
För användning med (applikation) Neutralization, Control
Formulering PBS, 1M urea with no preservative; pH 7.4
Gen-ID (Entrez) 8833
Namn Human GMPS (aa 13-152) Control Fragment
pH-intervall 7.4
Reningsmetod Purified
Kvantitet 100 μL
Förvaringskrav -20°C, Avoid Freeze/Thaw Cycles
Regulatorisk status RUO
Gene Alias AA591640; AI047208; Glutamine amidotransferase; GMP synthase; GMP synthase [glutamine-hydrolyzing]; GMP synthetase; GMPS; guanine monophosphate synthase; guanine monophosphate synthetase; guanine monphosphate synthase; guanine monphosphate synthetase; guanosine 5'-monophosphate synthase; MLL/GMPS fusion protein; testicular tissue protein Li 82
Vanligt namn GMPS
Gensymbol GMPS
Produkttyp Protein
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens AGGDLKDGHHHYEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLT
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.