missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human GPR56 Partial ORF (NP_758961, 31 a.a. - 130 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
4515.00 SEK - 6845.00 SEK
Specifications
| Accession Number | NP_758961 |
|---|---|
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 9289 |
| Molecular Weight (g/mol) | 36.74kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16120336
|
Abnova™
H00009289-Q01.25UG |
25 ug |
6845.00 SEK
25µg |
Estimated Shipment: 24-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16110336
|
Abnova™
H00009289-Q01.10UG |
10 ug |
4515.00 SEK
10µg |
Estimated Shipment: 24-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
This gene encodes a member of the G protein-coupled receptor family. The protein contains 7 transmembrane domains and a mucin-like domain in the N-terminal region. The gene is implicated in the regulation of brain cortical patterning. The protein binds specifically to transglutaminase 2 in the extracellular space. Expression of this gene is downregulated in melanoma cell lines, and overexpression of this gene can suppress tumor growth and metastasis. Mutations in this gene result in bilateral frontoparietal polymicrogyria. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: DFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLASpecifications
| NP_758961 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| BFPP/DKFZp781L1398/TM7LN4/TM7XN1 | |
| GPR56 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 9289 | |
| GPR56 (Human) Recombinant Protein (Q01) | |
| DFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLA | |
| RUO | |
| GPR56 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |