missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human GRID1 Partial ORF (NP_060021, 349 a.a. - 441 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
3970.00 SEK - 6025.00 SEK
Specifications
Accession Number | NP_060021 |
---|---|
For Use With (Application) | Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) |
Format | Liquid |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 2894 |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16135751
|
Abnova™
H00002894-Q01.25UG |
25 ug |
6025.00 SEK
25µg |
Estimated Shipment: 09-05-2023 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! |
16125751
|
Abnova™
H00002894-Q01.10UG |
10 ug |
3970.00 SEK
10µg |
Estimated Shipment: 09-05-2023 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! |
Description
This gene encodes a subunit of glutamate receptor channels. These channels mediate most of the fast excitatory synaptic transmission in the central nervous system and play key roles in synaptic plasticity
Sequence: LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKVSpecifications
NP_060021 | |
Liquid | |
2894 | |
GRID1 (Human) Recombinant Protein (Q01) | |
LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKV | |
RUO | |
GRID1 | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.97kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
KIAA1220 | |
GRID1 | |
Yes | |
wheat germ expression system |