missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HBG1 Partial ORF (NP_000550, 44 a.a. - 106 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003047-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16136021

  • 5030.41 SEK / 25µg

Estimated Shipment: 18-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'. [provided by RefSeq]

Sequence: DSFGNLSSASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVDPENFKL
Specifications

Specifications

NP_000550
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.67kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DSFGNLSSASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVDPENFKL
RUO
HBG1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3047
HBG1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HBGA/HBGR/HSGGL1/PRO2979
HBG1
Yes
Videos
SDS
Documents
Certificates