missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human HLA-DMB (aa 18-118) Control Fragment Recombinant Protein

Produktkod. 30199099
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30199099

Brand: Invitrogen™ RP90111

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52923 (PA5-52923. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HLA-DMB (major histocompatibility complex, class II, DM beta), also known as D6S221E, RING7, HLA-DM histocompatibility type, beta chain, HLADMB or RING7, is a protein that in humans is encoded by the HLA-DMB gene. The HLA-DMB gene is mapped on 6p21.32. HLA-DMB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta (DMB) chain, both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP (class II-associated invariant chain peptide) molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells. The beta chain is approximately 26-28 kDa and its gene contains 6 exons. HLA-DMA and -DMB appear to encode subunits of a functional heterodimer that is critical in the pathway of class II antigen presentation. HLA and MHC antibodies play a significant role in Immunopeptidomics, facilitating the identification and characterization of neoantigens through high-performance liquid chromatography coupled to tandem Mass Spectrometry.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer P28068
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 3109
Namn Human HLA-DMB (aa 18-118) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias class II histocompatibility antigen, M beta chain; D6S221E; DAAP-27A1.4; DMB; HLA class II histocompatibility antigen, DM beta chain; HLA-DMB; major histocompatibility complex, class II, DM beta; MHC class II antigen DMB; MHC class II antigen HLA-DM beta chain; MHC class II HLA-DMB; really interesting new gene 7 protein; RING7
Vanligt namn HLA-DMB
Gensymbol HLA-DMB
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens AGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQ
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.