missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human HLA-DOA (aa 25-74) Control Fragment Recombinant Protein

Produktkod. 30198670
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30198670

Brand: Invitrogen™ RP109842

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Reacts with HLA-DO, a heterodimer formed by DNalpha and DObeta subunits in B cells. DNalpha and DObeta are the products of the non-classical class II genes, HLA-DNA and HLA-DOB, respectively. DO forms tight complexes with DM in the endoplasmic reticulum and is thereby sorted to lysosomal vesicles during antigen processing and presentation. It is tightly associated with DM and it is selectively expressed on antigen-presenting cells, such as B cells, dendritic cells and thymic epithelial cells. DO can enhance the efficiency of peptide loading and has been found to stabilize DM at low pH, preserving its chaperon activity. DO-DM complexes are more efficient than DM in protecting empty DR molecules. Reports describe DO as a co-chaperone of DM. HLA and MHC antibodies play a significant role in Immunopeptidomics, facilitating the identification and characterization of neoantigens through high-performance liquid chromatography coupled to tandem Mass Spectrometry.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer P06340
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 3111
Namn Human HLA-DOA (aa 25-74) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias HLA class II histocompatibility antigen, DO alpha chain; HLA-D0-alpha; HLA-DNA; HLA-DOA; HLADZ; HLA-DZA; lymphocyte antigen; major histocompatibility complex, class II, DN alpha; major histocompatibility complex, class II, DO alpha; MHC class II antigen DOA; MHC DN-alpha; MHC DZ alpha
Vanligt namn HLA-DOA
Gensymbol HLA-DOA
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens ATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEF
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.