missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human HLA-DPB1 Control Fragment Recombinant Protein

Produktkod. 30209235
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
30209235 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30209235 Leverantör Invitrogen™ Leverantörsnummer RP90436

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82411 (PA5-82411. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules. HLA and MHC antibodies play a significant role in Immunopeptidomics, facilitating the identification and characterization of neoantigens through high-performance liquid chromatography coupled to tandem Mass Spectrometry.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer P04440
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 3115
Namn Human HLA-DPB1 Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias beta1 domain MHC class II HLA DPB; CD; CELIAC1; class II HLA beta chain; DC-1 alpha chain; DC-alpha; DPB1; DQ-A1; GSE; histocompatibility antigen HLA-DR alpha; HLA class II histocompatibility antigen, DP beta 1 chain; HLA class II histocompatibility antigen, DP(W4) beta chain; HLA class II histocompatibility antigen, DQ alpha 1 chain; HLA class II histocompatibility antigen, DQ(W3) alpha chain; HLA class II histocompatibility antigen, DR alpha chain; HLA DP14-beta chain; HLA-DCA; HLA-DP; HLA-DP histocompatibility type, beta-1 subunit; HLA-DP1B; HLA-DPB; HLA-DPB1; HLA-DQA; HLA-DQA1; HLA-DRA; HLA-DRA1; leucocyte antigen DQA1; leukocyte antigen alpha chain; major histocompatibility complex class II antigen beta chain; major histocompatibility complex, class II, DP beta 1; major histocompatibility complex, class II, DQ alpha 1; major histocompatibility complex, class II, DR alpha; MHC cell surface glycoprotein; MHC cla; MHC class II antigen; MHC class II antigen beta chain; MHC class II antigen DP beta 1 chain; MHC class II antigen DPB1; MHC class II antigen DPbeta1; MHC class II antigen DRA; MHC class II DQA1; MHC class II HLA-D alpha glycoprotein; MHC class II HLA-DP-beta-1; MHC class II HLA-DQ-alpha-1; MHC class II HLA-DRB1; MHC class II surface glycoprotein; MHC HLA DPB1; MHC HLA-DQ alpha; MLRW
Vanligt namn HLA-DPB1
Gensymbol HLA-DPB1
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens YNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTF
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.