missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human HLA-DQA1 Control Fragment Recombinant Protein

Produktkod. 30201411
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30201411

Brand: Invitrogen™ RP90588

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52927 (PA5-52927. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs, other cells of the gastrointestinal tract, such as epithelial cells, express MHC class II molecules and CD74 and act as APCs, which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs, CD74 undergoes a sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal microenvironment has been implicated in the regulation of antigen loading into MHC II molecules, increased acidification produces increased proteolysis and efficient peptide loading. HLA and MHC antibodies play a significant role in Immunopeptidomics, facilitating the identification and characterization of neoantigens through high-performance liquid chromatography coupled to tandem Mass Spectrometry.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer P01909
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 3117
Namn Human HLA-DQA1 Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias CD; CELIAC1; DC-1 alpha chain; DC-alpha; DQ-A1; DX alpha chain; DX-ALPHA; GSE; HLA class II antigen; HLA class II histocompatibility antigen, DQ alpha 1 chain; HLA class II histocompatibility antigen, DQ alpha 2 chain; HLA class II histocompatibility antigen, DQ beta 1 chain; HLA class II histocompatibility antigen, DQ(6) alpha chain; HLA class II histocompatibility antigen, DQ(W3) alpha chain; HLA-DCA; HLA-DQA; HLA-DQA1; HLA-DQA2; HLA-DQB; HLA-DQB1; HLA-DRB1; HLA-DXA; IDDM1; leucocyte antigen DQA1; leukocyte antigen alpha chain; lymphocyte antigen; major histocompatibility complex, class II, DQ alpha 1; major histocompatibility complex, class II, DQ alpha 2; major histocompatibility complex, class II, DQ beta 1; MHC class II antigen; MHC class II antigen DQB1; MHC class II antigen HLA-DQ-beta-1; MHC class II DQ beta chain; MHC class II DQA1; MHC class II DQA2; MHC class II HLA-D alpha glycoprotein; MHC class II HLA-DQ beta glycoprotein; MHC class II HLA-DQ-alpha-1; MHC class II surface glycoprotein; MHC class2 antigen; MHC DQ beta; MHC HLA-DQ alpha
Vanligt namn HLA-DQA1
Gensymbol HLA-DQA1
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens DHVASCGVNLYQFYGPSGQYTHEFDGDEQFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSKSPVTLGQPNTLI
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.