missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human HOOK2 Partial ORF (NP_037444, 138 a.a. - 237 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00029911-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
Hook proteins are cytosolic coiled-coil proteins that contain conserved N-terminal domains, which attach to microtubules, and more divergent C-terminal domains, which mediate binding to organelles. The Drosophila Hook protein is a component of the endocytic compartment.[supplied by OMIM]
Sequence: LEESVQHVVMEAIQELMTKDTPDSLSPETYGNFDSQSRRYYFLSEEAEEGDELQQRCLDLERQLMLLSEEKQSLAQENAGLRERMGRPEGEGTPGLTAKKSpecifications
| NP_037444 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| LEESVQHVVMEAIQELMTKDTPDSLSPETYGNFDSQSRRYYFLSEEAEEGDELQQRCLDLERQLMLLSEEKQSLAQENAGLRERMGRPEGEGTPGLTAKK | |
| RUO | |
| HOOK2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 29911 | |
| HOOK2 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ26218/HK2 | |
| HOOK2 | |
| Recombinant | |
| wheat germ expression system |