missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HSF1 Partial ORF (NP_005517.1, 256 a.a. - 359 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003297-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16064185

  • 4865.00 SEK / 25µg


Estimated Shipment
12-02-2021
Add to basket

Description

Description

The product of this gene is a heat-shock transcription factor. Transcription of heat-shock genes is rapidly induced after temperature stress. Hsp90, by itself and/or associated with multichaperone complexes, is a major repressor of this gene. [provided by RefSeq]

Sequence: DAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEG
Specifications

Specifications

NP_005517.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.18kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEG
RUO
HSF1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3297
HSF1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HSTF1
HSF1
Yes
Videos
SDS
Documents