missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HTR2C Partial ORF (NP_000859, 1 a.a. - 52 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003358-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16136491

  • 5030.41 SEK / 25µg

Estimated Shipment: 25-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Serotonin (5-hydroxytryptamine, 5-HT), a neurotransmitter, elicits a wide array of physiological effects by binding to several receptor subtypes, including the 5-HT2 family of seven-transmembrane-spanning, G-protein-coupled receptors, which activate phospholipase C and D signaling pathways. This gene encodes the 2C subtype of serotonin receptor and its mRNA is subject to multiple RNA editing events, where genomically encoded adenosine residues are converted to inosines. RNA editing is predicted to alter amino acids within the second intracellular loop of the 5-HT2C receptor and generate receptor isoforms that differ in their ability to interact with G proteins and the activation of phospholipase C and D signaling cascades, thus modulating serotonergic neurotransmission in the central nervous system. Studies in humans have reported abnormalities in patterns of 5-HT2C editing in depressed suicide victims. [provided by RefSeq]

Sequence: MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPDGV
Specifications

Specifications

NP_000859
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.46kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPDGV
RUO
HTR2C
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3358
HTR2C (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
5-HT2C/5-HTR2C/HTR1C
HTR2C
Yes
Videos
SDS
Documents
Certificates