missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human IBRDC1 Partial ORF (NP_689766, 2 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00154214-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16162197

  • 4055.00 SEK / 10µg
Estimated Shipment: 21-06-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: KVQLGQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESKYKIQCPTCQFVWCFKCHSPWHE
Specifications

Specifications

NP_689766
Liquid
154214
IBRDC1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C6orf172/IBRDC1/MGC26996/dJ84N20.1
RNF217
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KVQLGQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESKYKIQCPTCQFVWCFKCHSPWHE
RUO
RNF217
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers