missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ID3 Partial ORF (NP_002158, 1 a.a. - 83 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003399-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16116551

  • 3860.70 SEK / 10µg
Estimated Shipment: 29-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Members of the ID family of helix-loop-helix (HLH) proteins lack a basic DNA-binding domain and inhibit transcription through formation of nonfunctional dimers that are incapable of binding to DNA.[supplied by OMIM]

Sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV
Specifications

Specifications

NP_002158
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.87kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV
RUO
ID3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3399
ID3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HEIR-1/bHLHb25
ID3
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers