missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human IDO1 Partial ORF (NP_002155.1, 304 a.a. - 403 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003620-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16136901

  • 5030.41 SEK / 25µg

Estimated Shipment: 10-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Gamma-interferon (IFNG; MIM 147570) has an antiproliferative effect on many tumor cells and inhibits intracellular pathogens such as Toxoplasma and Chlamydia, at least partly because of the induction of indoleamine 2,3-dioxygenase (INDO; EC 1.13.11.52). This enzyme catalyzes the degradation of the essential amino acid L-tryptophan to N-formyl-kynurenine.[supplied by OMIM]

Sequence: RNFLCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLKTVRSTTEKSLLKEG
Specifications

Specifications

NP_002155.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue
RNFLCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLKTVRSTTEKSLLKEG
RUO
IDO1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3620
IDO1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CD107B/IDO/INDO
IDO1
Yes
Videos
SDS
Documents
Certificates