missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human IK Partial ORF (NP_006074, 458 a.a. - 557 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003550-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16136721

  • 3343.96 SEK / 10µg

Estimated Shipment: 10-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene was identified by its RED repeat, a stretch of repeated arginine, glutamic acid and aspartic acid residues. The protein localizes to discrete dots within the nucleus, excluding the nucleolus. Its function is unknown. This gene maps to chromosome 5; however, a pseudogene may exist on chromosome 2. [provided by RefSeq]

Sequence: VDSDEEVDYSKMDQGNKKGPLGRWDFDTQEEYSEYMNNKEALPKAAFQYGIKMSEGRKTRRFKETNDKAELDRQWKKISAIIEKRKKMEADGVEVKRPKY
Specifications

Specifications

NP_006074
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
VDSDEEVDYSKMDQGNKKGPLGRWDFDTQEEYSEYMNNKEALPKAAFQYGIKMSEGRKTRRFKETNDKAELDRQWKKISAIIEKRKKMEADGVEVKRPKY
RUO
IK
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3550
IK (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CSA2/MGC59741/RED
IK
Yes
Videos
SDS
Documents
Certificates