missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human IL11 Partial ORF (NP_000632.1, 25 a.a. - 74 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003589-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16064245

  • 3234.00 SEK / 10µg


Estimated Shipment
03-02-2021
Add to basket

Description

Description

Sequence: PPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDS
Specifications

Specifications

NP_000632.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.24kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDS
RUO
IL11
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3589
IL11 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AGIF|IL-11
IL11
Yes
Videos
SDS
Documents