missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human IL17RD Partial ORF (NP_060033, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00054756-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16137726

  • 3343.96 SEK / 10µg

Estimated Shipment: 16-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Fibroblast growth factors (FGFs; see MIM 603726) are secreted proteins involved in cellular proliferation, migration, differentiation, and survival. FGF activity is negatively regulated by members of the 'sprouty' family (e.g., SPRY1, MIM 602465). The SEF protein is a modulator of FGF signaling.[supplied by OMIM]

Sequence: MESQPFLNMKFETDYFVKVVPFPSIKNESNYHPFFFRTRACDLLLQPDNLACKPFWKPRNLNISQHGSDMQVSFDHAPHNFGFRFFYLHYKLKHEGPFKR
Specifications

Specifications

NP_060033
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MESQPFLNMKFETDYFVKVVPFPSIKNESNYHPFFFRTRACDLLLQPDNLACKPFWKPRNLNISQHGSDMQVSFDHAPHNFGFRFFYLHYKLKHEGPFKR
RUO
IL17RD
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
54756
IL17RD (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp434N1928/FLJ35755/IL-17RD/IL17RLM/MGC133309/SEF
IL17RD
Yes
Videos
SDS
Documents
Certificates