missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ILKAP Partial ORF (NP_110395, 293 a.a. - 392 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00080895-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16130367

  • 3343.96 SEK / 10µg

Estimated Shipment: 09-11-2021

Please to purchase this item. Need a web account? Register with us today!


Beschreibung

Beschreibung

The protein encoded by this gene is a protein serine/threonine phosphatase of the PP2C family. This protein can interact with integrin-linked kinase (ILK/ILK1), a regulator of integrin mediated signaling, and regulate the kinase activity of ILK. Through the interaction with ILK, this protein may selectively affect the signaling process of ILK-mediated glycogen synthase kinase 3 beta (GSK3beta), and thus participate in Wnt signaling pathway. [provided by RefSeq]

Sequence: IGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKSAADARYEAACNRLANKAVQRGSADNVTVMVVRIGH
Spezifikation

Spezifikation

NP_110395
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
IGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKSAADARYEAACNRLANKAVQRGSADNVTVMVVRIGH
RUO
ILKAP
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
80895
ILKAP (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp434J2031/FLJ10181/MGC4846/PP2C-DELTA
ILKAP
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate