missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human IMMP2L Partial ORF (NP_115938, 31 a.a. - 102 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00083943-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16120587

  • 5854.80 SEK / 25µg
Estimated Shipment: 04-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The mitochondrial inner membrane peptidase (IMP) complex generates mature, active proteins in the mitochondrial intermembrane space by proteolytically removing the mitochondrial targeting presequence of nuclear-encoded proteins. IMP1 (IMMP1L; MIM 612323) and IMP2 are the catalytic subunits of the IMP complex (Burri et al., 2005 [PubMed 15814844]).[supplied by OMIM]

Sequence: DRVACVARVEGASMQPSLNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALEGDIVR
Specifications

Specifications

NP_115938
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.66kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DRVACVARVEGASMQPSLNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALEGDIVR
RUO
IMMP2L
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
83943
IMMP2L (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
IMP2/IMP2-LIKE
IMMP2L
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers