missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human IMP3 Full-length ORF (NP_060755.1, 1 a.a. - 184 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00055272-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16181353

  • 3343.96 SEK / 10µg

Estimated Shipment: 12-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes the human homolog of the yeast Imp3 protein. The protein localizes to the nucleoli and interacts with the U3 snoRNP complex. The protein contains an S4 domain. [provided by RefSeq]

Sequence: MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA
Specifications

Specifications

NP_060755.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
48.3kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BRMS2/C15orf12/DKFZp586L0118/FLJ10968/MRPS4
IMP3
Yes
wheat germ expression system
Liquid
55272
IMP3 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA
RUO
IMP3
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates