missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human INPP1 Partial ORF (NP_002185, 300 a.a. - 399 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003628-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16176921

  • 5030.41 SEK / 25µg

Estimated Shipment: 16-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes the enzyme inositol polyphosphate-1-phosphatase, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 1 of the inositol ring from the polyphosphates inositol 1,4-bisphosphate and inositol 1,3,4-trisphophosphate. [provided by RefSeq]

Sequence: GLVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQLVYHVENEGAAGVDRWANKGGLIAYRSRKRLETFLSLLVQNLAPAETHT
Specifications

Specifications

NP_002185
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GLVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQLVYHVENEGAAGVDRWANKGGLIAYRSRKRLETFLSLLVQNLAPAETHT
RUO
INPP1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3628
INPP1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC110984
INPP1
Yes
Videos
SDS
Documents
Certificates