missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human IRGM Partial ORF (XP_293893.3, 99 a.a. - 181 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00345611-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16132857

  • 3343.96 SEK / 10µg

Estimated Shipment: 09-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Members of the p47 immunity-related GTPase (IRG) family, including IRGM, play an important role in the murine immune system; however, in humans this resistance system is greatly reduced. There is evidence that human IRGM plays a role in autophagy and control of intracellular mycobacteria (Bekpen et al., 2005; Singh et al., 2006 [PubMed 16888103]).[supplied by OMIM]

Sequence: TTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY
Specifications

Specifications

XP_293893.3
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.87kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
TTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY
RUO
IRGM
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
345611
IRGM (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
IFI1/IRGM1/LRG-47/LRG47/MGC149263/MGC149264
IRGM
Yes
Videos
SDS
Documents
Certificates