missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human JUN Partial ORF (AAH68522.1, 1 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003725-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16117061

  • 5854.80 SEK / 25µg
Estimated Shipment: 27-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. [provided by RefSeq]

Sequence: MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGF
Specifications

Specifications

AAH68522.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGF
RUO
JUN
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3725
JUN (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AP-1/AP1/c-Jun
JUN
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers