missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human JUN Partial ORF (AAH68522.1, 1 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

3860.70 SEK - 5854.80 SEK

Specifications

Name JUN (Human) Recombinant Protein (Q01)
Recombinant Yes
For Use With (Application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Molecular Weight 37.84kDa
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16117061
View Documents Promotion Details
Abnova™
H00003725-Q01.25UG
25 ug
5854.80 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 07-03-2022
Please to purchase this item. Need a web account? Register with us today!
16107061
View Documents Promotion Details
Abnova™
H00003725-Q01.10UG
10 ug
3860.70 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 07-03-2022
Please to purchase this item. Need a web account? Register with us today!
Description

Description

This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. [provided by RefSeq]

Sequence: MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGF
Specifications

Specifications

JUN (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
37.84kDa
SDS
Product Certifications