missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human KLF5 Partial ORF (NP_001721, 358 a.a. - 457 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000688-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16063695

  • 3234.00 SEK / 10µg


Estimated Shipment
12-02-2021
Add to basket

Description

Description

This gene encodes a member of the Kruppel-like factor subfamily of zinc finger proteins. Since the protein localizes to the nucleus and binds the epidermal growth factor response element, it is thought to be a transcription factor. [provided by RefSeq]

Sequence: RYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN
Specifications

Specifications

NP_001721
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN
RUO
KLF5
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
688
KLF5 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BTEB2|CKLF|IKLF
KLF5
Yes
Videos
SDS
Documents