Learn More
Abnova™ Human KRTAP13-1 Partial ORF (NP_853630.1, 2 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00140258-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
Hair keratins and hair keratin-associated proteins (KAPs), such as KRTAP13-1, are the main structural proteins of hair fibers (Rogers et al., 2002 [PubMed 12359730]).[supplied by OMIM]
Sequence: WHANSESSQCNSAELTSPINMSYNCCSGNFSSRSCGGYLHYPASSCGFSYPSNQVYSTDLCSPSTCQLGSSLYRGCQQTCWEPTSCQTSYVESSPCQTSSpecifications
NP_853630.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.63kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
WHANSESSQCNSAELTSPINMSYNCCSGNFSSRSCGGYLHYPASSCGFSYPSNQVYSTDLCSPSTCQLGSSLYRGCQQTCWEPTSCQTSYVESSPCQTS | |
RUO | |
KRTAP13-1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
140258 | |
KRTAP13-1 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
KAP13.1/KRTAP13.1 | |
KRTAP13-1 | |
Recombinant | |
wheat germ expression system |