missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human LAMP1 (aa 211-339) Control Fragment Recombinant Protein

Produktkod. 30209562
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
30209562 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30209562 Leverantör Invitrogen™ Leverantörsnummer RP90558

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LAMP1 (CD107a, lysosome-associated membrane protein-1) together with LAMP-2, is a major constituent of lysosomal membrane, 1-2% of total CD107a is found also on the plasma membrane. LAMP1 is a heavily glycosylated membrane protein which contains a putative signal peptide, 18 sites for N-linked glycosylation, a single membrane-spanning segment and a short (11 amino acid) cytosolic tail. The LAMP proteins are involved in lysosome biogenesis and are required for fusion of lysosomes with phagosomes. LAMP1 is a type 1 integral membrane protein that is transported from trans-Golgi network to endosomes and then lysosomes. Upon cell activation, LAMP1 transfer to the plasma membrane is dependent on a carboyxl-terminal tyrosine based motif (YXXI). Perturbation in the spacing between the tyrosine based motif relative to the membrane abolishes lysosome localization of LAMP1, and this mutant protein then cycles between the plasma membrane and the endosome. Cell surface LAMP1 (and LAMP2) have been shown to promote adhesion of human peripheral blood mononuclear cells (PBMC) to vascular endothelium, therefore, they are possibly involved in the adhesion of PBMC to the site of inflammation. Increased LAMP1 immunoreactivity is observed in neurons and glial cells surrounding senile plaques in Alzheimer’s Disease (AD) cases, and is localized in medullary epithelial cells, single macrophages and lymphocytes in acute thymic involution. LAMP1 is a good marker of mast cell activation.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer P11279
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 3916
Namn Human LAMP1 (aa 211-339) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias 120 kDa lysosomal membrane glycoprotein; AI196048; CD107 antigen-like family member A; CD107a; I79_011073; Lamp I; LAMP1; LAMP-1; LAMPA; LGP120; LGP-120; LGPA; LGP-A; lysosomal associated membrane protein 1; Lysosomal associated membrane protein 1 (120 kDa); lysosomal membrane glycoprotein 1; lysosomal membrane glycoprotein A; lysosomal-associated membrane protein 1; lysosome-associated membrane glycoprotein 1; LYSOSOME-ASSOCIATED MEMBRANE GLYCOPROTEIN 1 PRECURSOR (LAMP-1) (LGP-A) (LGP-120) (CD107A) (P2B); lysosome-associated membrane protein 1; P2B
Vanligt namn LAMP1 (CD107a)
Gensymbol LAMP1
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens SPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCN
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.