missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LOC283155 Partial ORF (XP_208545, 207 a.a. - 297 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00283155-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16132687

  • 6150.00 SEK / 25µg
Estimated Shipment: 03-10-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: RRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKMLAKMVESQDVKI
Specifications

Specifications

XP_208545
Liquid
283155
LOC283155 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
LOC283155
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.75kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKMLAKMVESQDVKI
RUO
LOC283155
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers