missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human Lysozyme (aa 82-147) Control Fragment Recombinant Protein Product Code.: 30200637
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200637

Invitrogen™ Human Lysozyme (aa 82-147) Control Fragment Recombinant Protein

Product Code. 30200637
100 μL, 100µL
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200637

Brand: Invitrogen™ RP100897

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111271 (PA5-111271. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the anti-microbial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. Missense mutations in LYZ have been identified in heritable renal amyloidosis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P61626
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4069
Name Human Lysozyme (aa 82-147) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1,4-beta-N-acetylmuramidase C; 1700038F02Rik; 4-beta-N-acetylmuramidase C; AI326280; Allergen Gal d IV; bA534G20.1; c-type lysozyme; dystrophin; egg white lysozyme; Gal d 4; KAAG648; LYC2; Lys; Lysm; lysozyme; lysozyme (renal amyloidosis); lysozyme 1; lysozyme 2; lysozyme C; Lysozyme C type M; lysozyme C type P; Lysozyme C, spleen isozyme; lysozyme C-1; Lysozyme C-2; lysozyme C-3; lysozyme d1; lysozyme F1; lysozyme like 1; lysozyme-like 1; lysozyme-like protein 1; lysozyme-like protein 2; Lysz; LYZ; Lyz1; Lyz2; LYZC; LYZD1; LYZF1; LYZL1; Lyzs; Lzm; Lzm-s1; Lzp; Lzp-s; P lysozyme structural; PRO1278; renal amyloidosis; RGD1559869; unnamed protein product; UNQ648/PRO1278
Common Name Lysozyme
Gene Symbol LYZ
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence WCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Invitrogen™ Human Lysozyme (aa 82-147) Control Fragment Recombinant Protein >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.