Learn More
Abnova™ Human MAP2K6 Partial ORF (AAH12009, 231 a.a. - 334 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
3970.00 SEK - 6025.00 SEK
Specifications
| Accession Number | AAH12009 |
|---|---|
| For Use With (Application) | Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) |
| Format | Liquid |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 5608 |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16133455
|
Abnova™
H00005608-Q01.25UG |
25 ug |
6025.00 SEK
25µg |
Estimated Shipment: 04-05-2023 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! |
16123455
|
Abnova™
H00005608-Q01.10UG |
10 ug |
3970.00 SEK
10µg |
Estimated Shipment: 04-05-2023 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! |
Description
This gene encodes a member of the dual specificity protein kinase family, which functions as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. As an essential component of p38 MAP kinase mediated signal transduction pathway, this gene is involved in many cellular processes such as stress induced cell cycle arrest, transcription activation and apoptosis. [provided by RefSeq]
Sequence: QKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGDSpecifications
| AAH12009 | |
| Liquid | |
| 5608 | |
| MAP2K6 (Human) Recombinant Protein (Q01) | |
| QKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD | |
| RUO | |
| MAP2K6 | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.18kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MAPKK6/MEK6/MKK6/PRKMK6/SAPKK3 | |
| MAP2K6 | |
| Yes | |
| wheat germ expression system |