missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MAP3K11 Partial ORF (NP_002410, 741 a.a. - 847 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00004296-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16064405

  • 3234.00 SEK / 10µg


Estimated Shipment
03-02-2021
Add to basket

Description

Description

Sequence: PPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSRIDPWSFVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFQGGPQDCRAQTKDMGAQAPWVPEAGP
Specifications

Specifications

NP_002410
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.51kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSRIDPWSFVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFQGGPQDCRAQTKDMGAQAPWVPEAGP
RUO
MAP3K11
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
4296
MAP3K11 (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC17114|MLK-3|MLK3|PTK1|SPRK
MAP3K11
Yes
Videos
SDS
Documents