missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MEN1 Partial ORF (NP_000235, 506 a.a. - 615 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00004221-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16177751

  • 5030.41 SEK / 25µg

Estimated Shipment: 03-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes menin, a putative tumor suppressor associated with a syndrome known as multiple endocrine neoplasia type 1. In vitro studies have shown menin is localized to the nucleus, possesses two functional nuclear localization signals, and inhibits transcriptional activation by JunD, however, the function of this protein is not known. Two messages have been detected on northern blots but the larger message has not been characterized. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Sequence: DKGLGTGQGAVSGPPRKPPGTVAGTARGPEGGSTAQVPAPAASPPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTPSDYTLSFLKRQRKGL
Specifications

Specifications

NP_000235
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DKGLGTGQGAVSGPPRKPPGTVAGTARGPEGGSTAQVPAPAASPPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTPSDYTLSFLKRQRKGL
RUO
MEN1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
4221
MEN1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MEAI/SCG2
MEN1
Yes
Videos
SDS
Documents
Certificates