missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30212701

Invitrogen™ Human MICB (aa 331-381) Control Fragment Recombinant Protein

Produktkod. 30212701
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
30212701 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30212701 Leverantör Invitrogen™ Leverantörsnummer RP107349

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (33%), Rat (33%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66698 (PA5-66698. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MICB encodes the highly polymorphic MHC (HLA) class I chain-related gene B. The protein product is expressed on the cell surface. It is thought that MICB functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. MICB is broadly recognized by NK cells and T cells with NKG2D receptor on their surface. The complex NKG2D-MICB results in MICB expressing cytolytic T cells and NK cells against epithelial tumor cells.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer Q29980
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 4277
Namn Human MICB (aa 331-381) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias MHC class I chain-related protein B; MHC class I mic-B antigen; MHC class I polypeptide-related sequence B; MHC class I-like located near the LRC, 2; MHC class I-like molecule PERB11.2-IMX; MHC I like leukocyte 2; MICB; MIC-B; Mill2; Mill2 gene for MHC class I-like located near the LRC, 2, exon 3, partial cds, strain:LEW0.1 Lm1; PERB11.2; sMICB; soluble MICB; stress inducible class I homolog
Vanligt namn MICB
Gensymbol MICB
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens CKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTE
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.