missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MMP10 Partial ORF (NP_002416.1, 271 a.a. - 368 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00004319-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16131315

  • 5030.41 SEK / 25µg

Estimated Shipment: 09-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades proteoglycans and fibronectin. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. [provided by RefSeq]

Sequence: EPLVPTKSVPSGSEMPAKCDPALSFDAISTLRGEYLFFKDRYFWRRSHWNPEPEFHLISAFWPSLPSYLDAAYEVNSRDTVFIFKGNEFWAIRGNEVQ
Specifications

Specifications

NP_002416.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
EPLVPTKSVPSGSEMPAKCDPALSFDAISTLRGEYLFFKDRYFWRRSHWNPEPEFHLISAFWPSLPSYLDAAYEVNSRDTVFIFKGNEFWAIRGNEVQ
RUO
MMP10
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
4319
MMP10 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SL-2/STMY2
MMP10
Yes
Videos
SDS
Documents
Certificates